Form ccdc110
WebTissue Cell Type. Showing tissue cell type specific RNA data of CCDC110 (CT52, KM-HN-1, MGC33607). WebAnti-CCDC110 antibodies are offered by a number of suppliers. This target gene encodes the protein 'coiled-coil domain containing 110' in humans and may also be known as …
Form ccdc110
Did you know?
WebForm : Supplied as a liquid in PBS, pH 7.2, 0.09% sodium azide. Concentration : As reported ... 0.09% sodium azide. Purity: Purified by Protein A affinity chromatography. Immunogen: CCDC110 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 784-814 amino acids from the C-terminal region of … WebCoiled-coil domain containing 110 (CCDC110, KM-HN-1) is a protein containing C-terminal coiled-coil domain (CCD) which was previously discovered as a member of the human cancer/testis antigen...
WebCCDC110. GTR Test ID Help Each Test is a specific, orderable test from a particular laboratory, and is assigned a unique GTR accession number. The format is GTR00000001.1, with a leading prefix 'GTR' followed by 8 digits, a period, then 1 or more digits representing the version. When a laboratory updates a registered test, a new … WebCalifornia Courts - Home
WebCertificate of Service Maryland Courts Courts Certificate of Service Use this form to certify to the court that documents were mailed or hand delivered to a party in a case. … WebCreative Biogene offers Human CCDC110 adenoviral particles. Creative Biogene provides kits, reagents, and services that help researchers explore questions about gene discovery, regulation, and function...
WebMISSION® esiRNA targeting human CCDC110; find Sigma-Aldrich-EHU137771 MSDS, related peer-reviewed papers, technical documents, similar products & more at Sigma-Aldrich. US EN. ... form. lyophilized powder. esiRNA cDNA target sequence. Ensembl human accession no. ENSG00000168491. NCBI accession no.
WebForm: Liquid: Purification Method: Antigen affinity purification: Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol pH 7.3. Storage Conditions: ... "CCDC110 antibodies" comparison. At Proteintech, we pride ourselves on our antibody quality, customer service and transparency. As such, we are comparing our antibodies with other … oregon dept of veterans affairs salemWebJun 1, 2002 · Coiled-coil domain-containing protein 110. Gene. CCDC110. Status. UniProtKB reviewed (Swiss-Prot) Organism. Homo sapiens (Human) Amino acids. 833. how to unhide all the rows in excelWebKnow comprehensive CCDC110 protein information including protein sequence, molecular weight, theoretical pI, structure, function and protein interaction. how to unhide all the columns in excelWebCCDC110(256309) Description Immunogen Synthetic peptide directed towards the middle region of human CCDC110 Sequence Synthetic peptide located within the following region: KEELKKHSQENIKFENSISRLTEDKILLENYVRSIENERDTLEFEMRHLQ Physical form Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% … how to unhide and excel fileWebHow to make an signature for your CCC Contractor Form online ccdc contractor to design CCC contractor form? signNow combines ease of use, affordability and security in one online tool, all without forcing extra DDD … how to unhide all windows in excelWebcity/county ☐circuit court ☐ district court of maryland for located at case no. state of maryland . or . vs. motion for remote proceeding or to appear remotely (md. rules 2-802; … oregon dept transportation road conditionsWebRev. January 1, 2024, Mandatory Form Family Code, § 6200 et seq. à DV-110, *Full Name: Page 1 of 9 Instruction: The person asking for a restraining order must complete items 1, … oregon dept of weights and measures